PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn127441
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family B3
Protein Properties Length: 459aa    MW: 51253.5 Da    PI: 3.885
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn127441genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B335.22.1e-11651193387
                 -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
          B3  33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                 +  ++l   + r+We++l+y+   g++++t+GW++Fv++n L+ g ++ F+  +r
  Achn127441  65 QLLISLIGDEVREWEMTLKYSCAEGAFMITNGWEKFVQDNMLQGGNTIQFYKPNR 119
                 45678888888*******99999999************************93333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.75E-866134IPR015300DNA-binding pseudobarrel domain
PfamPF023622.3E-867123IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-767130IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.54668134IPR003340B3 DNA binding domain
CDDcd100172.53E-768115No hitNo description
Gene3DG3DSA:2.40.330.103.4E-11239329IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.86E-11243329IPR015300DNA-binding pseudobarrel domain
CDDcd100171.20E-9246324No hitNo description
PROSITE profilePS508638.586246353IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MDPKRFTGTE KKEQLKETKF DSNVSGEGEP SFSTPTDPAT EKENSDLMED PKSGNSPPGQ  60
ILPEQLLISL IGDEVREWEM TLKYSCAEGA FMITNGWEKF VQDNMLQGGN TIQFYKPNRR  120
RRNNHYNIRC IRGEEFGNAA TCHQGEGYLF QHPLTLDDVS SNRLIIPTEY ATSYFFGFES  180
MDEHVSGEGQ HPTTETESSN KINVSGDDSR SRSQTENSGF ATETEEEEEE EEEPGNSSSE  240
TEDENWPIQK RLTPTDVEEY LFLPFRSLSA YPDYFPRLSE PKDLLIIDSR NQFWSMKVVF  300
DQERDGYVVT GMWKEFVNKH KLKATQKIKL NIPYFGLGSE SSTYFNIVCM RKEGDSVTDL  360
SSMGSEENEG NSDDQSDDLD GNSDEQGDDE EGNSGKQGDD EGNSGDDEED DEEGNSGQQG  420
DDEGNPGDDE EGNLGEQGDD EGDSDDDDGG FSSQGSIN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-